PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g11950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WRKY
Protein Properties Length: 209aa    MW: 23166.9 Da    PI: 9.7238
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g11950genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.37.6e-3442100159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  CA09g11950  42 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFIGCPVRKHVERASHDLRAVITTYEGKHNHD 100
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-3727102IPR003657WRKY domain
SuperFamilySSF1182906.28E-3034102IPR003657WRKY domain
PROSITE profilePS5081137.90637102IPR003657WRKY domain
SMARTSM007741.4E-3842101IPR003657WRKY domain
PfamPF031064.4E-2643100IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MFFRVNCPFR KGDNENEVIS SASRTVREPR IVVQTTSDID ILDDGYRWRK YGQKVVKGNP  60
NPRSYYKCTF IGCPVRKHVE RASHDLRAVI TTYEGKHNHD VPAARGSGSY SMNKPPSGSN  120
NNMPVVPRPS LLANNSNQGM NVSNTLFNTA QVEPPITLQM LQSSGSSSYS GFGTSSGSYM  180
NQMQPTNNSK LISKEEPKDD LFFSSFLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-3933103878Probable WRKY transcription factor 4
2lex_A3e-3933103878Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3917470.0AY391747.1 Capsicum annuum WRKY transcription factor-a (WRKY-a) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004246308.11e-129PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-64WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLK4CRX31e-129K4CRX3_SOLLC; Uncharacterized protein
STRINGSolyc09g014990.2.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-64WRKY DNA-binding protein 33